PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang03g09320.1
Common NameLR48_Vigan09g164700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 228aa    MW: 25759.9 Da    PI: 7.7811
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang03g09320.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171358148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+ T+eEd+l+++ + +lG++ W++Ia +++ gRt++++k++w+++l
   Vang03g09320.1 13 RGNITPEEDDLIIRMHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 58
                     7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-7119IPR009057Homeodomain-like
SuperFamilySSF466897.7E-19267IPR009057Homeodomain-like
PROSITE profilePS5129427.357862IPR017930Myb domain
SMARTSM007177.9E-171260IPR001005SANT/Myb domain
PfamPF002491.1E-151358IPR001005SANT/Myb domain
CDDcd001674.53E-131758No hitNo description
Gene3DG3DSA:1.10.10.601.9E-232058IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
LRWMNYLRPD IKRGNITPEE DDLIIRMHSL LGNRWSLIAG RLPGRTDNEI KNYWNTHLSK  60
KLRNQGTDPK THHKLTVPPE KKKGKKKNKQ KHENKKGSSE KTLVYLPKAV RVKAVSCVPR  120
TESTFTLDSN SGSASTSQEK VQSPEEVARE VNMVWGVGNE GDHGGVGIFF GEDHDLVNTS  180
SYVECHSDDV HTDHGTLQKL YEEYLQLLKD EEKPADELDS FAQSLLV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1626248108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014491519.11e-153PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0L9VDB41e-168A0A0L9VDB4_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S4R31e-168A0A0S3S4R3_PHAAN; Uncharacterized protein
STRINGGLYMA03G41965.11e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.17e-39myb domain protein 5
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]